ATF6 Antikörper (AA 597-629)

Produktnummer ABIN5647025

Der Kaninchen Polyklonal anti-ATF6 Antikörper (ABIN5647025) detektiert spezifisch ATF6 in WB und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für ATF6 Antikörper (AA 597-629) (ABIN5647025)

Target: ATF6 (Activating Transcription Factor 6 (ATF6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATF6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-ATF6 Antikörper

Bindungsspezifität: AA 597-629

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 597-629 (AININENVINGQDYEVMMQIDCQVMDTRILHIK) from the human protein were used as the immunogen for the ATF6 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ATF6 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ATF6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ATF6

Target: ATF6 (Activating Transcription Factor 6 (ATF6))

Andere Bezeichnung: ATF6

Hintergrund: ATF6, a member of the leucine zipper protein family, is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. This gene is mapped to chromosome 1q23.3. ATF6 can constitutively induce the promoter of glucose-regulated protein (grp) genes through activation of the endoplasmic reticulum (ER) stress element (ERSE).

UniProt: P18850

Pathways: ER-Nucleus Signaling, Unfolded Protein Response