ALDH1B1 Antikörper (AA 116-156)
-
- Target Alle ALDH1B1 Antikörper anzeigen
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
-
Bindungsspezifität
- AA 116-156
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALDH1B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids 116-156 (RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKW from the human protein were used as the immunogen for the ALDH1B1 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product ALDH1B1 Primärantikörper
-
-
- Applikationshinweise
- Western blot: 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the ALDH1B1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
- Andere Bezeichnung
- ALDH1B1 (ALDH1B1 Produkte)
- Synonyme
- ALDH5 antikoerper, ALDHX antikoerper, rf2d antikoerper, 2700007F14Rik antikoerper, aldehyde dehydrogenase 1 family member B1 antikoerper, aldehyde dehydrogenase 5 antikoerper, aldehyde dehydrogenase 1 family, member B1 antikoerper, aldehyde dehydrogenase 3B1 antikoerper, hypothetical protein antikoerper, ALDH1B1 antikoerper, aldh5 antikoerper, Aldh1b1 antikoerper, MCYG_01035 antikoerper, MGYG_00956 antikoerper, PGTG_20239 antikoerper
- Hintergrund
- Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.
- UniProt
- P30837
-