ALDH1B1 Antikörper (N-Term)
-
- Target Alle ALDH1B1 Antikörper anzeigen
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
-
Bindungsspezifität
- AA 116-156, N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALDH1B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase X, mitochondrial(ALDH1B1) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- RVYLASLETL DNGKPFQESY ALDLDEVIKV YRYFAGWADK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase X, mitochondrial(ALDH1B1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: aldehyde dehydrogenase 1 family member B1
Protein Name: Aldehyde dehydrogenase X, mitochondrial - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product ALDH1B1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
- Andere Bezeichnung
- ALDH1B1 (ALDH1B1 Produkte)
- Synonyme
- ALDH5 antikoerper, ALDHX antikoerper, rf2d antikoerper, 2700007F14Rik antikoerper, aldehyde dehydrogenase 1 family member B1 antikoerper, aldehyde dehydrogenase 5 antikoerper, aldehyde dehydrogenase 1 family, member B1 antikoerper, aldehyde dehydrogenase 3B1 antikoerper, hypothetical protein antikoerper, ALDH1B1 antikoerper, aldh5 antikoerper, Aldh1b1 antikoerper, MCYG_01035 antikoerper, MGYG_00956 antikoerper, PGTG_20239 antikoerper
- Hintergrund
-
Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.
Synonyms: Acetaldehyde dehydrogenase 5 | Aldehyde dehydrogenase X | Aldh1b1 | ALDH5 | ALDHX | P30837 - Gen-ID
- 219
- UniProt
- P30837
-