Iba1 Antikörper (AA 99-133)

Produktnummer ABIN5647006

Produktdetails anti-Iba1 Antikörper

Target: Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))

Bindungsspezifität: AA 99-133

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Iba1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 99-133 (ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK) from the human protein were used as the immunogen for the IBA1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the IBA1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the IBA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Iba1

Target: Iba1 (IBA1) (Ionized Calcium-binding Adapter Molecule 1 (IBA1))

Andere Bezeichnung: IBA1 / AIF-1 (IBA1 Produkte)

Synonyme: AIF-1 antikoerper, IBA1 antikoerper, IRT-1 antikoerper, IRT1 antikoerper, AI607846 antikoerper, D17H6S50E antikoerper, G1 antikoerper, Iba1 antikoerper, Bart1 antikoerper, iba1 antikoerper, mrf-1 antikoerper, fa04b11 antikoerper, wu:fa04b11 antikoerper, AIF antikoerper, AIF1 antikoerper, aif1 antikoerper, allograft inflammatory factor 1 antikoerper, AIF1 antikoerper, Aif1 antikoerper, aif1 antikoerper

Hintergrund: Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1 (IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.

UniProt: P55008

Pathways: Smooth Muscle Cell Migration