MPP1 Antikörper (AA 409-450)

Produktnummer ABIN5646989

Produktdetails anti-MPP1 Antikörper

Target: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Bindungsspezifität: AA 409-450

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 409-450 (TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF) from the human protein were used as the immunogen for the MPP1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the MPP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu MPP1

Target: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Andere Bezeichnung: MPP1 (MPP1 Produkte)

Synonyme: AAG12 antikoerper, DXS552E antikoerper, EMP55 antikoerper, MRG1 antikoerper, PEMP antikoerper, MGC53500 antikoerper, MGC89895 antikoerper, MPP1 antikoerper, p55 antikoerper, cb997 antikoerper, zgc:77039 antikoerper, wu:fc85f03 antikoerper, 55kDa antikoerper, C130070C03Rik antikoerper, membrane palmitoylated protein 1 antikoerper, membrane protein, palmitoylated 1 L homeolog antikoerper, membrane protein, palmitoylated 1 antikoerper, membrane protein, palmitoylated antikoerper, MPP1 antikoerper, mpp1.L antikoerper, mpp1 antikoerper, Mpp1 antikoerper

Hintergrund: Membrane Palmitoylated Protein 1, also called '55 kDa erythrocyte membrane protein,' is a protein that in humans is encoded by the MPP1 gene. This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q00013