MPP1 Antikörper (AA 409-450)

Produktnummer ABIN5646989

Dieses Anti-MPP1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MPP1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für MPP1 Antikörper (AA 409-450) (ABIN5646989)

Target: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MPP1 Antikörper

Bindungsspezifität: AA 409-450

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 409-450 (TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF) from the human protein were used as the immunogen for the MPP1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the MPP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu MPP1

Target: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Andere Bezeichnung: MPP1

Hintergrund: Membrane Palmitoylated Protein 1, also called '55 kDa erythrocyte membrane protein,' is a protein that in humans is encoded by the MPP1 gene. This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q00013