Integrin alpha 3b Antikörper (Cytoplasmic Domain, N-Term)

Produktnummer ABIN5621198

Dieser Maus Monoklonal Antikörper detektiert spezifisch Integrin alpha 3b in IHC, WB und IHC (fro). Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für Integrin alpha 3b Antikörper (Cytoplasmic Domain, N-Term) (ABIN5621198)

Target: Integrin alpha 3b

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Integrin alpha 3b Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))

Klon: 54B3

Produktdetails anti-Integrin alpha 3b Antikörper

Bindungsspezifität: Cytoplasmic Domain, N-Term

Spezifität: Recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart

Kreuzreaktivität (Details): Human

Produktmerkmale: Mouse monoclonal Integrin alpha 3B antibody

Immunogen: Integrin alpha 3B antibody was raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin as the immunogen.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: IHC: 1:25-1:200, WB: 1:100-1:1000

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: Supplied in PBS containing 0.09 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C

Details zu Integrin alpha 3b

Target: Integrin alpha 3b