Integrin alpha 3b (N-Term) Antikörper

Details zu Produkt Nr. ABIN2295556
Antigen
Epitop
N-Term
2
1
Reaktivität
Human
3
Wirt
Maus
3
Klonalität (Klon)
Monoklonal ()
Applikation
Immunochromatography (IC), Immunohistochemistry (IHC), Western Blotting (WB)
3
3
2
1
1
Optionen
Immunogen Synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to KLH
Sequenz CTRYYQIMPK YHAVRIREEE RYPPPGSTLP TKK
Klon 54B3
Isotyp IgG1
Kreuzreaktivität Human
Kreuzreaktivität (Details) Calculated cross reactivity: Hu
Produktmerkmale Integrin alpha 3B
Reinigung Purified by Protein G affinity chromatography.
Antigen
Applikations-hinweise Optimal working conditions should be determined by the investigator.
Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung -20°C
Haben Sie etwas anderes gesucht?