Integrin alpha 3b Antikörper (Cytoplasmic Domain, N-Term)

Produktnummer ABIN5621198

Dieses Maus Monoklonal-Antikörper erkennt spezifisch Integrin alpha 3b in IHC, WB und IHC (fro). Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Integrin alpha 3b Antikörper (Cytoplasmic Domain, N-Term) (ABIN5621198)

Target: Integrin alpha 3b

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Integrin alpha 3b Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))

Klon: 54B3

Produktdetails anti-Integrin alpha 3b Antikörper

Bindungsspezifität: Cytoplasmic Domain, N-Term

Spezifität: Recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart

Kreuzreaktivität (Details): Human

Produktmerkmale: Mouse monoclonal Integrin alpha 3B antibody

Immunogen: Integrin alpha 3B antibody was raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin as the immunogen.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: IHC: 1:25-1:200, WB: 1:100-1:1000

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: Supplied in PBS containing 0.09 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C

Details zu Integrin alpha 3b

Target: Integrin alpha 3b