Integrin alpha 3a Antikörper (Cytoplasmic Domain, N-Term, Non-phosphorylated)

Produktnummer ABIN5618629

Dieser Anti-Integrin alpha 3a Antikörper ist ein Maus Monoklonal Antikörper zur Detektion von Integrin alpha 3a in IHC, WB und IHC (fro). Geeignet für Human.

Kurzübersicht für Integrin alpha 3a Antikörper (Cytoplasmic Domain, N-Term, Non-phosphorylated) (ABIN5618629)

Target: Integrin alpha 3a

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Integrin alpha 3a Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro))

Klon: 158A3

Produktdetails anti-Integrin alpha 3a Antikörper

Bindungsspezifität: Cytoplasmic Domain, N-Term, Non-phosphorylated

Spezifität: Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A

Kreuzreaktivität (Details): Human

Produktmerkmale: Mouse monoclonal Integrin alpha 3A antibody

Immunogen: Integrin alpha 3A antibody was raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin as the immunogen.

Isotyp: IgG2a

Anwendungsinformationen

Applikationshinweise: IHC: 1:100-1:200, WB: 1:100-1:1000

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: Supplied in PBS containing 0.09 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C

Details zu Integrin alpha 3a

Target: Integrin alpha 3a