Integrin alpha 3a (Cytoplasmic Domain) Antikörper

Details zu Produkt Nr. ABIN2295550
Cytoplasmic Domain
Klonalität (Klon)
Monoklonal ()
Immunochromatography (IC), Immunohistochemistry (IHC), Western Blotting (WB)
Immunogen Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Klon 29A3
Isotyp IgG1
Kreuzreaktivität Human
Kreuzreaktivität (Details) Calculated cross reactivity: Hu
Produktmerkmale Integrin alpha 3A
Reinigung Purified by Protein G affinity chromatography.
Applikations-hinweise Optimal working conditions should be determined by the investigator.
Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung -20°C
Haben Sie etwas anderes gesucht?