Integrin alpha 3a (Cytoplasmic Domain) Antikörper

Details zu Produkt Nr. ABIN2295550
Antigen
Epitop
Cytoplasmic Domain
2
1
1
1
Reaktivität
Human
6
Wirt
Maus
5
1
Klonalität (Klon)
Monoklonal ()
Applikation
Immunochromatography (IC), Immunohistochemistry (IHC), Western Blotting (WB)
6
5
3
2
2
1
Optionen
Immunogen Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Sequenz CRTRALYEAK RQKAEMKSQP SETERLTDDY
Klon 29A3
Isotyp IgG1
Kreuzreaktivität Human
Kreuzreaktivität (Details) Calculated cross reactivity: Hu
Produktmerkmale Integrin alpha 3A
Reinigung Purified by Protein G affinity chromatography.
Antigen
Applikations-hinweise Optimal working conditions should be determined by the investigator.
Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung -20°C