SIX3 Antikörper (N-Term)
-
- Target Alle SIX3 Antikörper anzeigen
- SIX3 (Sine Oculis-Related Homeobox 3 (SIX3))
-
Bindungsspezifität
- AA 1-32, N-Term
-
Reaktivität
- Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SIX3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Homeobox protein SIX3(SIX3) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- MVFRSPLDLY SSHFLLPNFA DSHHRSILLA SS
- Kreuzreaktivität (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Produktmerkmale
-
Rabbit IgG polyclonal antibody for Homeobox protein SIX3(SIX3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: SIX homeobox 3
Protein Name: Homeobox protein SIX3 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Six3 (1-32aa MVFRSPLDLYSSHFLLPNFADSHHRSILLASS), different from the related mouse sequence by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product SIX3 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SIX3 (Sine Oculis-Related Homeobox 3 (SIX3))
- Andere Bezeichnung
- SIX3 (SIX3 Produkte)
- Synonyme
- HPE2 antikoerper, SIX3 antikoerper, cb347 antikoerper, six3.2 antikoerper, six6 antikoerper, E130112M24Rik antikoerper, Six3a antikoerper, Six3alpha antikoerper, Six3b antikoerper, Six3beta antikoerper, six3 antikoerper, six3.1 antikoerper, wu:fc10a08 antikoerper, SIX homeobox 3 antikoerper, SIX homeobox 3b antikoerper, sine oculis-related homeobox 3 antikoerper, SIX homeobox 3a antikoerper, sine oculis homeobox homolog 3 antikoerper, SIX3 antikoerper, six3b antikoerper, Six3 antikoerper, six3a antikoerper, six3 antikoerper
- Hintergrund
-
Homeobox protein SIX3 is a protein that in humans is encoded by the SIX3 gene. This gene encodes a member of the sine oculishomeobox transcription factor family. The encoded protein plays a role in eye development. Mutations in SIX3 are the cause of a severe brain malformation, called holoprosencephaly type 2 (HPE2). In HPE2, the brain fails to separate into two hemispheres during early embryonic development, leading to eye and brain malformations, which result in serious facial abnormalities. A mutant zebrafish knockout model has been developed, in which the anterior part of the head was missing due to the atypical increase of Wnt1 activity. When injected with SIX3, these zebrafish embryos were able to successfully develop a normal forebrain. When SIX3 was turned off in mice, resulting in a lack of retina formation due to excessive expression of Wnt8b in the region where the forebrain normally develops. Both of these studies demonstrate the importance of SIX3 activity in brain and eye development.
Synonyms: Homeobox protein SIX3, Sine oculis homeobox homolog 3, SIX3 - Gen-ID
- 6496
- UniProt
- O95343
- Pathways
- Protein targeting to Nucleus
-