ErbB2/Her2 Antikörper (N-Term)

Produktnummer ABIN5518830

Produktdetails anti-ErbB2/Her2 Antikörper

Target: ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

Bindungsspezifität: AA 29-64, N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ErbB2/Her2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Receptor tyrosine-protein kinase erbB-2(ERBB2) detection. Tested with WB, IHC-P in Human,Rat.

Sequenz: TDMKLRLPAS PETHLDMLRH LYQGCQVVQG NLELTY

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Receptor tyrosine-protein kinase erbB-2(ERBB2) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: erb-b2 receptor tyrosine kinase 2
Protein Name: Receptor tyrosine-protein kinase erbB-2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ErbB 2 (29-64aa TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-ErbB2/Her2 Antikörper (ABIN5518830)

Zhang, Zhang, Ruan, Zhang, He, Gao: "Lapatinib-incorporated lipoprotein-like nanoparticles: preparation and a proposed breast cancer-targeting mechanism." in: Acta pharmacologica Sinica, Vol. 35, Issue 6, pp. 846-52, (2015) (PubMed).

Tao, Suhua, Juanjuan, Zongzhi, Juan, Dandan: "In vitro study on human cytomegalovirus affecting early pregnancy villous EVT's invasion function." in: Virology journal, Vol. 8, pp. 114, (2011) (PubMed).

Details zu ErbB2/Her2

Target: ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

Andere Bezeichnung: ERBB2 (ErbB2/Her2 Produkte)

Synonyme: CD340 antikoerper, HER-2 antikoerper, HER-2/neu antikoerper, HER2 antikoerper, MLN 19 antikoerper, NEU antikoerper, NGL antikoerper, TKR1 antikoerper, Erbb-2 antikoerper, Neu antikoerper, c-erbB2 antikoerper, c-neu antikoerper, mKIAA3023 antikoerper, wu:fv70f10 antikoerper, zgc:63601 antikoerper, erb2 antikoerper, erb-b2 receptor tyrosine kinase 2 antikoerper, ERBB2 antikoerper, Erbb2 antikoerper, erbb2 antikoerper

Hintergrund: Receptor tyrosine-protein kinase erbB-2, also known as CD340 (cluster of differentiation 340), proto-oncogene Neu, Erbb2 (rodent), or ERBB2 (human), is a protein that in humans is encoded by the ERBB2 gene. And it is also frequently called HER2 (from human epidermal growth factor receptor 2) or HER2/neu. This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

Synonyms: C erb B2/neu protein | Cerb B2/neu protein | CD340 | CD340 antigen | CerbB2 | ERBB2 | HER 2 | HER 2/NEU | HER2 | Herstatin | MLN19 | MLN 19 | NEU | NGL | p185erbB2 | TKR1 | P04626

Gen-ID: 2064

UniProt: P04626

Pathways: RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Skeletal Muscle Fiber Development