ATF6 Antikörper (C-Term)

Produktnummer ABIN5518809

Produktdetails anti-ATF6 Antikörper

Target: ATF6 (Activating Transcription Factor 6 (ATF6))

Bindungsspezifität: AA 597-629, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATF6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Cyclic AMP-dependent transcription factor ATF-6 alpha(ATF6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: AININENVIN GQDYEVMMQI DCQVMDTRIL HIK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Cyclic AMP-dependent transcription factor ATF-6 alpha(ATF6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: activating transcription factor 6
Protein Name: Cyclic AMP-dependent transcription factor ATF-6 alpha

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ATF6

Target: ATF6 (Activating Transcription Factor 6 (ATF6))

Andere Bezeichnung: ATF6 (ATF6 Produkte)

Synonyme: ATF-6-like antikoerper, GB16435 antikoerper, ATF6 antikoerper, Atf6 antikoerper, ATF6A antikoerper, 9130025P16Rik antikoerper, 9630036G24 antikoerper, AA789574 antikoerper, Atf6alpha antikoerper, ESTM49 antikoerper, activating transcription factor 6 antikoerper, uncharacterized LOC412432 antikoerper, activating transcription factor 6 S homeolog antikoerper, cyclic AMP-dependent transcription factor ATF-6 alpha antikoerper, ATF6 antikoerper, LOC412432 antikoerper, atf6.S antikoerper, LOC100122162 antikoerper, Atf6 antikoerper

Hintergrund: ATF6, a member of the leucine zipper protein family, is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. This gene is mapped to chromosome 1q23.3. ATF6 can constitutively induce the promoter of glucose-regulated protein (grp) genes through activation of the endoplasmic reticulum (ER) stress element (ERSE).

Synonyms: Cyclic AMP-dependent transcription factor ATF-6 alpha | cAMP-dependent transcription factor ATF-6 alpha | Activating transcription factor 6 alpha | ATF6-alpha | Processed cyclic AMP-dependent transcription factor ATF-6 alpha | ATF6 | P18850

Gen-ID: 22926

UniProt: P18850

Pathways: ER-Nucleus Signaling, Unfolded Protein Response