Nanog Antikörper (Middle Region)

Produktnummer ABIN5518779

Produktdetails anti-Nanog Antikörper

Target: Nanog (NANOG) (Nanog Homeobox (NANOG))

Bindungsspezifität: AA 115-155, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Nanog Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Homeobox protein NANOG(NANOG) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: QRQKYLSLQQ MQELSNILNL SYKQVKTWFQ NQRMKSKRWQ K

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Homeobox protein NANOG(NANOG) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Nanog homeobox
Protein Name: Homeobox protein NANOG

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Nanog (115-155aa QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK), different from the related mouse sequence by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Nanog

Target: Nanog (NANOG) (Nanog Homeobox (NANOG))

Andere Bezeichnung: NANOG (NANOG Produkte)

Synonyme: 2410002E02Rik antikoerper, ENK antikoerper, ecat4 antikoerper, NANOG antikoerper, hacp antikoerper, wu:fd19e04 antikoerper, wu:fd20a07 antikoerper, zgc:193933 antikoerper, Nanog homeobox antikoerper, nanog homeobox antikoerper, Nanog antikoerper, NANOG antikoerper, nanog antikoerper

Hintergrund: NANOG (pron. nanOg) is a transcription factor critically involved with self-renewal of undifferentiated embryonic stem cells. In humans, this protein is encoded by the NANOG gene. It is mapped to 12p13.31. NANOG is thought to be a key factor in maintaining pluripotency. Moreover, NANOG is also thought to function in concert with other factors such as POU5F1 (Oct-4) and SOX2 to establish ESC identity. The NANOG protein has been found to be a transcriptional activator for the Rex1 promoter, playing a key role in sustaining Rex1 expression. Knockdown of NANOG in embryonic stem cells results in a reduction of Rex1 expression, while forced expression of NANOG stimulates Rex1 expression.

Synonyms: ENK | NANOG | Q9H9S0

Gen-ID: 79923

UniProt: Q9H9S0

Pathways: Stem Cell Maintenance