FZD10 Antikörper

Produktnummer ABIN5516677

Der Kaninchen Polyklonal Anti-FZD10-Antikörper wurde für IF validiert. Er ist geeignet, FZD10 in Proben von Human, Maus, Schwein, Rind (Kuh), Hund und Pferd zu detektieren.

Kurzübersicht für FZD10 Antikörper (ABIN5516677)

Target: FZD10 (Frizzled Family Receptor 10 (FZD10))

Reaktivität: Human, Maus, Schwein, Rind (Kuh), Hund, Pferd

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD10 Antikörper ist unkonjugiert

Applikation: Immunofluorescence (IF)

Produktdetails anti-FZD10 Antikörper

Sequenz: GMWIWTSKTL QSWQQVCSRR LKKKSRRKPA SVITSGGIYK KAQHPQKTHH

Homologie: Cow: 92%, Dog: 92%, Horse: 92%, Human: 100%, Mouse: 92%, Pig: 100%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Details zu FZD10

Target: FZD10 (Frizzled Family Receptor 10 (FZD10))

Andere Bezeichnung: FZD10

Hintergrund: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.

Alias Symbols: Fz10, FzE7, CD350, FZ-10, hFz10,

Protein Size: 581

Gen-ID: 11211

NCBI Accession: NM_007197, NP_009128

UniProt: Q9ULW2

Pathways: WNT Signalweg