Nerve Growth Factor Receptor (TNFRSF16) Associated Protein 1 (NGFRAP1) (AA 1-101) Antikörper

Details zu Produkt Nr. ABIN525799
Antigen
Epitop
AA 1-101
8
8
7
7
5
3
2
1
1
1
1
Reaktivität
Human
80
35
23
Wirt
Maus
69
7
5
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
4
4
3
3
3
2
2
2
2
2
2
1
1
1
1
1
Applikation
Immunofluorescence (IF), Western Blotting (WB)
53
37
13
13
12
8
2
1
1
1
Optionen
Verwendungszweck Mouse polyclonal antibody raised against a full-length human NGFRAP1 protein.
Marke MaxPab®
Immunogen

immunogen: NGFRAP1 (NP_996800.1, 1 a.a. ~ 101 a.a) full-length human protein.

Immunogen Sequence: MEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Kreuzreaktivität Human
Antigen
Andere Bezeichnung NGFRAP1 (NGFRAP1 Antibody Abstract)
Hintergrund Full Gene Name: nerve growth factor receptor (TNFRSF16) associated protein 1
Synonyms: BEX3,Bex,DXS6984E,HGR74,NADE
Gen-ID 27018
NCBI Accession NP_996800, NM_206917
Pathways Neurotrophin Signalübertragung, Positive Regulation of Endopeptidase Activity
Applikations-hinweise Optimal working dilution should be determined by the investigator.
Kommentare

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Beschränkungen Nur für Forschungszwecke einsetzbar
Buffer In 1x PBS, pH 7.4
Handhabung Aliquot to avoid repeated freezing and thawing.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Bilder des Herstellers
Image no. 1 for anti-Nerve Growth Factor Receptor (TNFRSF16) Associated Protein 1 (NGFRAP1) (AA 1-101) antibody (ABIN525799) Western Blot analysis of NGFRAP1 expression in transfected 293T cell line by NGFRAP1 ...
Image no. 2 for anti-Nerve Growth Factor Receptor (TNFRSF16) Associated Protein 1 (NGFRAP1) (AA 1-101) antibody (ABIN525799) Immunofluorescence of purified MaxPab antibody to NGFRAP1 on HeLa cell. [antibody con...