Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

Leupaxin (LPXN) (AA 1-386) Antikörper Primary Antibody

LPXN Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
Produktnummer ABIN522862
$600.00
Zzgl. Versandkosten $45.00
50 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 11 bis 12 Werktagen
  • Target
    Leupaxin (LPXN)
    Bindungsspezifität
    AA 1-386
    • 8
    • 8
    • 7
    • 7
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Reaktivität
    Human
    • 43
    • 29
    • 20
    • 1
    Wirt
    Maus
    • 43
    • 1
    Klonalität
    Polyklonal
    • 44
    Konjugat
    Unkonjugiert
    • 13
    • 5
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Applikation
    Western Blotting (WB)
    • 28
    • 21
    • 13
    • 6
    • 5
    • 1
    • 1
    • 1
    Verwendungszweck
    Mouse polyclonal antibody raised against a full-length human LPXN protein.
    Marke
    MaxPab®
    Kreuzreaktivität
    Human
    Immunogen

    immunogen: LPXN (NP_004802.1, 1 a.a. ~ 386 a.a) full-length human protein.

    Immunogen Sequence: MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL

  • Applikationshinweise
    Optimal working dilution should be determined by the investigator.
    Kommentare

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Buffer
    In 1x PBS, pH 7.4
    Handhabung
    Aliquot to avoid repeated freezing and thawing.
    Lagerung
    -20 °C
    Informationen zur Lagerung
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Leupaxin (LPXN)
    Andere Bezeichnung
    LPXN (LPXN Antibody Abstract)
    Synonyme
    LDPL, 4933402K05Rik, A530083L21Rik, AV278559, MGC140379, leupaxin, hypothetical protein, Leupaxin, LPXN, Lpxn, lpxn, PAAG_03110, PGTG_11441
    Hintergrund
    Full Gene Name: leupaxin
    Synonyms: LDPL
    Gen-ID
    9404
    NCBI Accession
    NP_004802, NM_004811
Sie sind hier:
help Kundenservice