SLC11A1 Antikörper (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 1) (AA 1-178)

Details for Product anti-SLC11A1 Antibody No. ABIN520254
Antigen
  • SLC11A1
  • NRAMP1
  • LSH
  • NRAMP
  • Bcg
  • Itg
  • Lsh
  • Nramp1
  • Ity
  • Nramp
  • ity
  • BCG
  • solute carrier family 11 member 1 L homeolog
  • solute carrier family 11 member 1
  • solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1
  • slc11a1.L
  • SLC11A1
  • Slc11a1
Epitop
AA 1-178
10
4
4
3
2
2
1
1
1
1
1
1
1
1
1
Reaktivität
Human
35
9
6
3
3
3
2
2
2
2
1
1
Wirt
Maus
34
4
Klonalität
Polyklonal
Konjugat
Dieser SLC11A1 Antikörper ist unkonjugiert
2
2
2
1
1
1
Applikation
Western Blotting (WB)
35
19
4
4
3
2
2
2
2
1
1
1
Optionen
Verwendungszweck Mouse polyclonal antibody raised against a full-length human SLC11A1 protein.
Marke MaxPab®
Immunogen

immunogen: SLC11A1 (AAH41787.1, 1 a.a. ~ 178 a.a) full-length human protein.

Immunogen Sequence: MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLRNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRYHPSVPQLFRPGREQLLLLPPLTSPSQSLFYPAVPSEAGLLPCFPEM

Kreuzreaktivität Human
Plasmids, Primers & others Plasmide, Primers & weitere SLC11A1 products on genomics-online (e.g. as negative or positive controls)
Antigen
Andere Bezeichnung SLC11A1 (SLC11A1 Antibody Abstract)
Hintergrund Full Gene Name: solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1
Synonyms: LSH,NRAMP,NRAMP1
Gen-ID 6556
Pathways Transition Metal Ion Homeostasis, Production of Molecular Mediator of Immune Response, Protein targeting to Nucleus
Applikations-hinweise Optimal working dilution should be determined by the investigator.
Kommentare

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Beschränkungen Nur für Forschungszwecke einsetzbar
Buffer In 1x PBS, pH 7.4
Handhabung Aliquot to avoid repeated freezing and thawing.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 1 (SLC11A1) (AA 1-178) antibody (ABIN520254) Western Blot analysis of SLC11A1 expression in transfected 293T cell line by SLC11A1 ...
Haben Sie etwas anderes gesucht?