Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2 (SLC11A2) (AA 1-65) Antikörper

Details zu Produkt Nr. ABIN518431
Antigen
  • DCT1
  • DMT1
  • NRAMP2
  • Nramp2
  • mk
  • van
  • Dmt1
  • ATNRAMP2
  • F8G22.4
  • F8G22_4
  • NRAMP metal ion transporter 2
  • dct1
  • dmt1
  • nramp2
  • SLC11A2
  • cb426
  • fa07b10
  • wu:fa07b10
  • zgc:136699
  • solute carrier family 11 member 2
  • solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
  • NRAMP metal ion transporter 2
  • manganese transport protein
  • metal transporter Nramp2
  • solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2
  • SLC11A2
  • Slc11a2
  • NRAMP2
  • LOC9327403
  • slc11a2
Epitop
AA 1-65
15
10
10
10
8
7
6
5
4
4
3
2
1
Reaktivität
Human
74
36
26
15
1
1
Wirt
Maus
92
16
Klonalität (Klon)
Monoklonal ()
Konjugat
Unkonjugiert
5
4
4
3
3
2
2
2
2
2
2
2
2
1
1
1
1
Applikation
Immunofluorescence (IF), ELISA, Western Blotting (WB)
69
53
25
20
16
16
11
5
4
4
2
1
Optionen
Verwendungszweck Mouse monoclonal antibody raised against a partial recombinant SLC11A2.
Immunogen

immunogen: SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF

Klon 4G2
Isotyp IgG2b kappa
Kreuzreaktivität Human
Antigen
Andere Bezeichnung SLC11A2 (SLC11A2 Antibody Abstract)
Hintergrund Full Gene Name: solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
Synonyms: DCT1,DMT1,FLJ37416,NRAMP2
Gen-ID 4891
NCBI Accession NP_000608, NM_000617
Pathways Transition Metal Ion Homeostasis, Proton Transport, Positive Regulation of Endopeptidase Activity
Applikations-hinweise Optimal working dilution should be determined by the investigator.
Kommentare

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Beschränkungen Nur für Forschungszwecke einsetzbar
Buffer In 1x PBS, pH 7.4
Handhabung Aliquot to avoid repeated freezing and thawing.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2 (SLC11A2) (AA 1-65) antibody (ABIN518431) Detection limit for recombinant GST tagged SLC11A2 is approximately 0.03ng/ml as a ca...
Image no. 2 for anti-Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2 (SLC11A2) (AA 1-65) antibody (ABIN518431) Western Blot detection against Immunogen (32.89 KDa) .
Image no. 3 for anti-Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2 (SLC11A2) (AA 1-65) antibody (ABIN518431) Immunofluorescence of monoclonal antibody to SLC11A2 on HeLa cell. [antibody concentr...
Haben Sie etwas anderes gesucht?