SLC11A2 Antikörper (N-Term)

Produktnummer ABIN635359

Produktdetails anti-SLC11A2 Antikörper

Target: SLC11A2 (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2 (SLC11A2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC11A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC11 A2 antibody was raised against the N terminal Of Slc11 2

Aufreinigung: Affinity purified

Immunogen: SLC11 A2 antibody was raised using the N terminal Of Slc11 2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC11A2 Blocking Peptide, catalog no. 33R-9663, is also available for use as a blocking control in assays to test for specificity of this SLC11A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC11A2

Target: SLC11A2 (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2 (SLC11A2))

Andere Bezeichnung: SLC11A2 (SLC11A2 Produkte)

Synonyme: DCT1 antikoerper, DMT1 antikoerper, NRAMP2 antikoerper, Nramp2 antikoerper, mk antikoerper, van antikoerper, Dmt1 antikoerper, ATNRAMP2 antikoerper, F8G22.4 antikoerper, F8G22_4 antikoerper, NRAMP metal ion transporter 2 antikoerper, dct1 antikoerper, dmt1 antikoerper, nramp2 antikoerper, SLC11A2 antikoerper, cb426 antikoerper, fa07b10 antikoerper, wu:fa07b10 antikoerper, zgc:136699 antikoerper, solute carrier family 11 member 2 antikoerper, solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 antikoerper, NRAMP metal ion transporter 2 antikoerper, manganese transport protein antikoerper, metal transporter Nramp2 antikoerper, solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2 antikoerper, SLC11A2 antikoerper, Slc11a2 antikoerper, NRAMP2 antikoerper, LOC9327403 antikoerper, slc11a2 antikoerper

Hintergrund: The SLC11A2 is a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport, Positive Regulation of Endopeptidase Activity