PPT1 Antikörper

Produktnummer ABIN4952244

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PPT1 in WB, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human und Ratte.

Kurzübersicht für PPT1 Antikörper (ABIN4952244)

Target: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-PPT1 Antikörper

Verwendungszweck: PPT1 Antibody

Sequenz: KEDVYRNHSI FLADINQERG INESYKKNLM ALKK

Aufreinigung: Antigen affinity

Immunogen: Amino acids KEDVYRNHSIFLADINQERGINESYKKNLMALKK of human PPT1 were used as the immunogen for the PPT1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the PPT1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the PPT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu PPT1

Target: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Andere Bezeichnung: PPT1

Hintergrund: Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.

UniProt: P50897

Pathways: SARS-CoV-2 Protein Interaktom