Fetuin A Antikörper

Produktnummer ABIN4950053

Dieses Anti-Fetuin A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Fetuin A in WB, ELISA, FACS und IHC (p). Geeignet für Human und Ratte.

Kurzübersicht für Fetuin A Antikörper (ABIN4950053)

Target: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Fetuin A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA, Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-Fetuin A Antikörper

Aufreinigung: Antigen affinity

Immunogen: Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the AHSG antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,ELISA: 0.1-0.5 μg/mL (human protein tested)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the AHSG antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Fetuin A

Target: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Andere Bezeichnung: Fetuin-A / AHSG

Hintergrund: Alpha-2-HS-glycoprotein (AHSG), also known as Fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.

UniProt: P02765