YAP1 Antikörper (N-Term)

Produktnummer ABIN4886772

Produktdetails anti-YAP1 Antikörper

Target: YAP1 (Yes-Associated Protein 1 (YAP1))

Bindungsspezifität: AA 62-97, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser YAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Transcriptional coactivator YAP1(YAP1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: ETDLEALFNA VMNPKTANVP QTVPMRLRKL PDSFFK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Transcriptional coactivator YAP1(YAP1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Yes associated protein 1
Protein Name: Transcriptional coactivator YAP1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human YAP1 (62-97aa ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu YAP1

Target: YAP1 (Yes-Associated Protein 1 (YAP1))

Andere Bezeichnung: YAP1 (YAP1 Produkte)

Synonyme: YAP antikoerper, YAP2 antikoerper, YAP65 antikoerper, YKI antikoerper, xyap antikoerper, yap antikoerper, yap2 antikoerper, yap65 antikoerper, yki antikoerper, AI325207 antikoerper, Yap antikoerper, Yap65 antikoerper, Yki antikoerper, Yorkie antikoerper, cb194 antikoerper, sb:cb194 antikoerper, si:ch211-181p1.5 antikoerper, si:dkey-3b8.3 antikoerper, wu:fc18c04 antikoerper, zgc:158380 antikoerper, Yes associated protein 1 antikoerper, Yes associated protein 1 S homeolog antikoerper, yes-associated protein 1 antikoerper, Yes-associated protein 1 antikoerper, YAP1 antikoerper, yap1.S antikoerper, Yap1 antikoerper, yap1 antikoerper

Hintergrund: YAP1, also known as YAP or YAP65, is a potent oncogene, which is amplified in various human cancers. This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. It is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

Synonyms: YAp 1 | YAp1 | YAP2 | YAP 65 | YAP65 | YKI | Yorkie homolog | P46937

Gen-ID: 10413

UniProt: P46937

Pathways: MAPK Signalweg, Stem Cell Maintenance, Regulation of Lipid Metabolism by PPARalpha