PVRL4 Antikörper (N-Term)

Produktnummer ABIN4886678

Produktdetails anti-PVRL4 Antikörper

Target: PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))

Bindungsspezifität: AA 53-94, N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PVRL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Nectin-4(NECTIN4) detection. Tested with WB in Human.

Sequenz: FYRGDSGEQV GQVAWARVDA GEGAQELALL HSKYGL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Nectin-4(NECTIN4) detection. Tested with WB in Human.
Gene Name: nectin cell adhesion molecule 4
Protein Name: Nectin-4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Nectin-4/PVRL4 (53-94aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PVRL4

Target: PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))

Andere Bezeichnung: NECTIN4 (PVRL4 Produkte)

Synonyme: PVRL4 antikoerper, si:ch211-155e24.1 antikoerper, 1200017F15Rik antikoerper, Prr4 antikoerper, RGD1559826 antikoerper, EDSS1 antikoerper, LNIR antikoerper, PRR4 antikoerper, nectin-4 antikoerper, nectin cell adhesion molecule 4 antikoerper, NECTIN4 antikoerper, nectin4 antikoerper, Nectin4 antikoerper

Hintergrund: PVRL4, also known as Nectin-4, is expressed in human skin, hair follicles, and cultured keratinocytes, but not in fibroblasts. This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.

Synonyms: EDSS1 | Nectin 4 | Nectin-4 | PRR4 | pvrl4 | Q96NY8

Gen-ID: 81607

Pathways: Cell-Cell Junction Organization