KRIT1 Antikörper (C-Term)

Produktnummer ABIN4886652

Produktdetails anti-KRIT1 Antikörper

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Bindungsspezifität: AA 703-736, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRIT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Krev interaction trapped protein 1(KRIT1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: ENKMSFIVHT KQAGLVVKLL MKLNGQLMPT ERNS

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Krev interaction trapped protein 1(KRIT1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: KRIT1, ankyrin repeat containing
Protein Name: Krev interaction trapped protein 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human KRIT1 (703-736aa ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS), different from the related mouse sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu KRIT1

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Andere Bezeichnung: KRIT1 (KRIT1 Produkte)

Synonyme: CAM antikoerper, CCM1 antikoerper, 2010007K12Rik antikoerper, A630036P20Rik antikoerper, AA432855 antikoerper, AI450393 antikoerper, AI643869 antikoerper, BB155247 antikoerper, BB235701 antikoerper, Ccm1 antikoerper, RGD1305929 antikoerper, krit1 antikoerper, fb36f07 antikoerper, san antikoerper, santa antikoerper, wu:fb36f07 antikoerper, zgc:63585 antikoerper, KRIT1, ankyrin repeat containing antikoerper, KRIT1 antikoerper, Krit1 antikoerper, krit1 antikoerper

Hintergrund: Krev interaction trapped protein 1(KRIT1) is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

Synonyms: CAM | CCM 1 | CCM1 | KRIT 1 | KRIT1 | O00522

Gen-ID: 889

UniProt: O00522

Pathways: Cell RedoxHomeostasis