IL7R Antikörper (C-Term)

Produktnummer ABIN4886632

Produktdetails anti-IL7R Antikörper

Target: IL7R (Interleukin 7 Receptor (IL7R))

Bindungsspezifität: AA 278-315, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL7R Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Interleukin-7 receptor subunit alpha(IL7R) detection. Tested with WB in Human,Rat.

Sequenz: DHKKTLEHLC KKPRKNLNVS FNPESFLDCQ IHRVDDIQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Interleukin-7 receptor subunit alpha(IL7R) detection. Tested with WB in Human,Rat.
Gene Name: interleukin 7 receptor
Protein Name: Interleukin-7 receptor subunit alpha

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu IL7R

Target: IL7R (Interleukin 7 Receptor (IL7R))

Andere Bezeichnung: IL7R (IL7R Produkte)

Synonyme: IL7R antikoerper, CD127 antikoerper, IL-7Ralpha antikoerper, CDW127 antikoerper, IL-7R-alpha antikoerper, IL7RA antikoerper, ILRA antikoerper, IL-7RA antikoerper, interleukin 7 receptor antikoerper, IL7R antikoerper, Il7r antikoerper

Hintergrund: The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).

Synonyms: CD 127 | CD127 | CD127 antigen | IL 7R alpha | IL-7R-alpha | IL 7R | IL7R | IL-7RA | IL7RA | IL7Ralpha | ILRA | Interleukin 7 receptor | P16871

Gen-ID: 3575

UniProt: P16871

Pathways: JAK-STAT Signalweg, Regulation of Leukocyte Mediated Immunity, Production of Molecular Mediator of Immune Response, Regulation of Cell Size