HDGF Antikörper (C-Term)

Produktnummer ABIN4886613

Produktdetails anti-HDGF Antikörper

Target: HDGF (Hepatoma-Derived Growth Factor (HDGF))

Bindungsspezifität: AA 61-97, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HDGF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KDLFPYEESK EKFGKPNKRK GFSEGLWEIE NNPTVKA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: hepatoma-derived growth factor
Protein Name: Hepatoma-derived growth factor

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu HDGF

Target: HDGF (Hepatoma-Derived Growth Factor (HDGF))

Andere Bezeichnung: HDGF (HDGF Produkte)

Synonyme: HMG1L2 antikoerper, hmg1l2 antikoerper, HDGF antikoerper, DKFZp459H185 antikoerper, AI118077 antikoerper, D3Ertd299e antikoerper, heparin binding growth factor antikoerper, hepatoma-derived growth factor antikoerper, hepatoma-derived growth factor (high-mobility group protein 1-like) antikoerper, heparin binding growth factor L homeolog antikoerper, hepatoma-derived growth factor-like antikoerper, HDGF antikoerper, hdgf antikoerper, Hdgf antikoerper, hdgf.L antikoerper, LOC100357981 antikoerper

Hintergrund: Hepatoma-derived growth factor (HDGF), also known as high mobility group protein 1-like 2 (HMG-1L2), is a protein that in humans is encoded by the HDGF gene. This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. And this gene was thought initially to be located on chromosome X, however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Synonyms: HDGF | HMG-1L2 | HMG1L2 | P51858

Gen-ID: 3068

UniProt: P51858

Pathways: ER-Nucleus Signaling