GADD45A Antikörper (C-Term)

Produktnummer ABIN4886599

Produktdetails anti-GADD45A Antikörper

Target: GADD45A (Growth Arrest and DNA-Damage-Inducible, alpha (GADD45A))

Bindungsspezifität: AA 125-165, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GADD45A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Growth arrest and DNA damage-inducible protein GADD45 alpha(GADD45A) detection. Tested with WB in Human.

Sequenz: VLVTNPHSSQ WKDPALSQLI CFCRESRYMD QWVPVINLP

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Growth arrest and DNA damage-inducible protein GADD45 alpha(GADD45A) detection. Tested with WB in Human.
Gene Name: growth arrest and DNA-damage-inducible, alpha
Protein Name: Growth arrest and DNA damage-inducible protein GADD45 alpha

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GADD45A (125-165aa VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLP ER), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu GADD45A

Target: GADD45A (Growth Arrest and DNA-Damage-Inducible, alpha (GADD45A))

Andere Bezeichnung: GADD45A (GADD45A Produkte)

Synonyme: MGC53491 antikoerper, zgc:91795 antikoerper, gadd45a antikoerper, GADD45A antikoerper, ddit1 antikoerper, gadd45 antikoerper, GADD45 antikoerper, AA545191 antikoerper, Ddit1 antikoerper, DDIT1 antikoerper, Gadd45 antikoerper, growth arrest and DNA damage inducible alpha L homeolog antikoerper, growth arrest and DNA-damage-inducible, alpha, b antikoerper, growth arrest and DNA damage inducible alpha antikoerper, growth arrest and DNA damage-inducible protein 45 antikoerper, growth arrest and DNA-damage-inducible 45 alpha antikoerper, growth arrest and DNA-damage-inducible, alpha antikoerper, gadd45a.L antikoerper, gadd45ab antikoerper, GADD45A antikoerper, gadd45a antikoerper, GADD45 antikoerper, Gadd45a antikoerper

Hintergrund: Growth arrest and DNA-damage-inducible protein GADD45 alpha (GADD45A) is a protein that in humans is encoded by the GADD45A gene. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. It is located on 1p34-p12. Sequence analysis of human and hamster cDNA clones demonstrated that the gene has been highly conserved and encodes a novel 165-amino acid polypeptide. Northern blot analysis detected moderate expression of a 1.4-kb GADD45A transcript in heart, skeletal muscle, and kidney, with little or no expression in brain, placenta, lung, liver, and pancreas. In addition, Gadd45a promotes epigenetic gene activation by repair-mediated DNA demethylation.

Synonyms: DDIT1 | DDIT-1 | DDIT1 | GADD45 | GA45A | GADD45A | P24522

Gen-ID: 1647

UniProt: P24522

Pathways: p53 Signalweg, Zellzyklus