AFF4 Antikörper (N-Term)
-
- Target Alle AFF4 Antikörper anzeigen
- AFF4 (AF4/FMR2 Family, Member 4 (AFF4))
-
Bindungsspezifität
- AA 6-53, N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AFF4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for AF4/FMR2 family member 4(AFF4) detection. Tested with WB in Human.
- Sequenz
- RNVLRMKERE RRNQEIQQGE DAFPPSSPLF AEPYKVTSKE DKLSSRIQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for AF4/FMR2 family member 4(AFF4) detection. Tested with WB in Human.
Gene Name: AF4/FMR2 family member 4
Protein Name: AF4/FMR2 family member 4 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4 (6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ), identical to the related mouse sequence.
- Isotyp
- IgG
- Top Product
- Discover our top product AFF4 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- AFF4 (AF4/FMR2 Family, Member 4 (AFF4))
- Andere Bezeichnung
- AFF4 (AFF4 Produkte)
- Synonyme
- AFF4 antikoerper, RA_m002_jsmFBA6Br antikoerper, AF5Q31 antikoerper, MCEF antikoerper, Alf4 antikoerper, Laf4l antikoerper, AF4/FMR2 family member 4 L homeolog antikoerper, AF4/FMR2 family member 4 antikoerper, AF4/FMR2 family, member 4 antikoerper, aff4.L antikoerper, AFF4 antikoerper, aff4 antikoerper, Aff4 antikoerper
- Hintergrund
-
The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.
Synonyms: AF5Q31 | Alf4 | CHOPS | HSPC092 | Laf4 | MCEF | Q9UHB7 - Gen-ID
- 27125
-