ACO2 Antikörper (C-Term)
-
- Target Alle ACO2 Antikörper anzeigen
- ACO2 (Aconitase 2, Mitochondrial (ACO2))
-
Bindungsspezifität
- AA 561-596, C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACO2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Aconitate hydratase, mitochondrial(ACO2) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- TSQRLQLLEP FDKWDGKDLE DLQILIKVKG KCTTDH
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Aconitate hydratase, mitochondrial(ACO2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: aconitase 2
Protein Name: Aconitate hydratase, mitochondrial - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Aconitase 2 (561-596aa TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product ACO2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ACO2 (Aconitase 2, Mitochondrial (ACO2))
- Andere Bezeichnung
- ACO2 (ACO2 Produkte)
- Synonyme
- DDBDRAFT_0206187 antikoerper, DDBDRAFT_0230168 antikoerper, DDB_0206187 antikoerper, DDB_0230168 antikoerper, aconitase 2 antikoerper, F10M23.310 antikoerper, F10M23_310 antikoerper, ACONM antikoerper, ICRD antikoerper, Aco-2 antikoerper, Aco3 antikoerper, D10Wsu183e antikoerper, cb1017 antikoerper, wu:fa10e03 antikoerper, wu:fb69g04 antikoerper, wu:fc20c11 antikoerper, aconitase 2 antikoerper, aconitase 2 S homeolog antikoerper, aconitate hydratase, mitochondrial antikoerper, aconitase, mitochondrial antikoerper, mitochondrial aconitate hydratase antikoerper, aconitase 2, mitochondrial antikoerper, Probable aconitate hydratase, mitochondrial antikoerper, ACO2 antikoerper, aco2.S antikoerper, Bm1_07420 antikoerper, aco2 antikoerper, ach1 antikoerper, Aco2 antikoerper, aco-2 antikoerper
- Hintergrund
-
Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
Synonyms: ACO 2 | ACO2 | aconitase 2 | aconitase2 | aconitase-2 | Aconitate hydratase | ACONM | Citrate hydro lyase | ICRD | Q99798 - Gen-ID
- 50
- UniProt
- Q99798
-