Integrin alpha 3a Antikörper

Produktnummer ABIN335346

Dieses Anti-Integrin alpha 3a-Antikörper ist ein Maus Monoklonal-Antikörper zur Detektion von Integrin alpha 3a in IHC, WB, IHC (fro) und ICC. Geeignet für Human. Dieses Primary Antibody wurde in 2+ Publikationen zitiert.

Kurzübersicht für Integrin alpha 3a Antikörper (ABIN335346)

Target: Integrin alpha 3a

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Integrin alpha 3a Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunocytochemistry (ICC)

Klon: 158A3

Produktdetails anti-Integrin alpha 3a Antikörper

Spezifität: Human. A broad species reactivity is expected because of the conserved nature of the epitope.

Aufreinigung: Purified

Immunogen: 158A3 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Isotyp: IgG2a

Anwendungsinformationen

Applikationshinweise: 158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit alpha3A. 158A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration, recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting applications.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Lagerung: 4 °C

Referenzen für anti-Integrin alpha 3a Antikörper (ABIN335346)

de Melker, Sterk, Delwel, Fles, Daams, Weening, Sonnenberg: "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization." in: Laboratory investigation; a journal of technical methods and pathology, Vol. 76, Issue 4, pp. 547-63, (1997) (PubMed).

Delwel, de Melker, Hogervorst, Jaspars, Fles, Kuikman, Lindblom, Paulsson, Timpl, Sonnenberg: "Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms." in: Molecular biology of the cell, Vol. 5, Issue 2, pp. 203-15, (1994) (PubMed).

Details zu Integrin alpha 3a

Target: Integrin alpha 3a

Hintergrund: Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.