Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

Integrin alpha 3a Antikörper

Für dieses Produkt sind 2+ Publikationen verfügbar. Der Maus-Monoklonal Anti-Integrin alpha 3a-Antikörper wurde für IHC, WB, IHC (fro) und ICC validiert. Er ist geeignet zum Nachweis von Integrin alpha 3a in Proben aus Human. }
Produktnummer ABIN335345
-15% Promotion 2026
463,12 €
544,85 €
Sparen Sie 81,73 € (-15 %)
Zzgl. Versandkosten 20,00 € und MwSt
0.1 mg
Lieferung nach: Deutschland
Lieferung in 2 bis 4 Werktagen

Kurzübersicht für Integrin alpha 3a Antikörper (ABIN335345)

Target

Integrin alpha 3a

Reaktivität

Human

Wirt

  • 3
Maus

Klonalität

  • 3
Monoklonal

Konjugat

  • 3
Dieser Integrin alpha 3a Antikörper ist unkonjugiert

Applikation

  • 3
  • 3
  • 2
  • 1
  • 1
Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunocytochemistry (ICC)

Klon

29A3
  • Spezifität

    Human. A broad species reactivity is expected because of the conserved nature of the epitope.

    Aufreinigung

    Purified

    Immunogen

    29A3 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

    Isotyp

    IgG1
  • Applikationshinweise

    29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A which is present in the basal cell layer in skin, glomeruli, Bowman€™s capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. 29A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration, recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting applications.

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Lagerung

    4 °C
  • de Melker, Sterk, Delwel, Fles, Daams, Weening, Sonnenberg: "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization." in: Laboratory investigation; a journal of technical methods and pathology, Vol. 76, Issue 4, pp. 547-63, (1997) (PubMed).

    Delwel, de Melker, Hogervorst, Jaspars, Fles, Kuikman, Lindblom, Paulsson, Timpl, Sonnenberg: "Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms." in: Molecular biology of the cell, Vol. 5, Issue 2, pp. 203-15, (1994) (PubMed).

  • Target

    Integrin alpha 3a

    Hintergrund

    Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.
Sie sind hier:
Chat with us!