IDO1 Antikörper (N-Term)

Produktnummer ABIN3043857

Produktdetails anti-IDO1 Antikörper

Target: IDO1 (Indoleamine 2,3-Dioxygenase 1 (IDO1))

Bindungsspezifität: AA 37-69, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IDO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Indoleamine 2,3-dioxygenase 1(IDO1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: NDWMFIAKHL PDLIESGQLR ERVEKLNMLS IDH

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Indoleamine 2,3-dioxygenase 1(IDO1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: indoleamine 2,3-dioxygenase 1
Protein Name: Indoleamine 2,3-dioxygenase 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-IDO1 Antikörper (ABIN3043857)

Li, Xu, Bai, Yang, Zhao, Zhang, Chen, Wang: "Umbilical Cord Tissue-Derived Mesenchymal Stem Cells Induce T Lymphocyte Apoptosis and Cell Cycle Arrest by Expression of Indoleamine 2, 3-Dioxygenase." in: Stem cells international, Vol. 2016, pp. 7495135, (2016) (PubMed).

Details zu IDO1

Target: IDO1 (Indoleamine 2,3-Dioxygenase 1 (IDO1))

Andere Bezeichnung: IDO1 (IDO1 Produkte)

Hintergrund: IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. By fluorescence in situ hybridization, the assignment is narrowed to chromosome 8p12-p11. INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase. During inflammation, IDO is upregulated in dendritic cells and phagocytes by proinflammatory stimuli, most notably IFNG, and the enzyme then uses superoxide as a 'cofactor' for oxidative cleavage of the indole ring of tryptophan, yielding an intermediate that deformylates to L-kynurenine.

Synonyms: 3-dioxygenase antibody|I23O1_HUMAN antibody|IDO 1 antibody|IDO antibody|IDO-1 antibody|IDO1 antibody|INDO antibody|indolamine 2,3 dioxygenase antibody|Indole 2 3 dioxygenase antibody|indoleamine 2 3 dioxygenase 1 antibody|indoleamine 2 3 dioxygenase antibody| Indoleamine 2,3-dioxygenase 1 antibody|Indoleamine pyrrole 2 3 dioxygenase antibody|Indoleamine-pyrrole 2 antibody

Gen-ID: 3620

UniProt: P14902

Pathways: Activated T Cell Proliferation