FMO3 Antikörper (C-Term)

Produktnummer ABIN3043830

Produktdetails anti-FMO3 Antikörper

Target: FMO3 (Flavin Containing Monooxygenase 3 (FMO3))

Bindungsspezifität: AA 404-433, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FMO3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 3(FMO3) detection. Tested with WB in Human,Mouse, Rat.

Sequenz: DMMNDINEKM EKKRKWFGKS ETIQTDYIVY

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 3(FMO3) detection. Tested with WB in Human,Mouse, Rat.
Gene Name: flavin containing monooxygenase 3
Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 3

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FMO3 (404-433aa DMMNDINEKMEKKRKWFGKSETIQTDYIVY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu FMO3

Target: FMO3 (Flavin Containing Monooxygenase 3 (FMO3))

Andere Bezeichnung: FMO3 (FMO3 Produkte)

Synonyme: MGC107820 antikoerper, FMOII antikoerper, TMAU antikoerper, dJ127D3.1 antikoerper, FM03 antikoerper, AW111792 antikoerper, flavin containing monooxygenase 3 antikoerper, flavin containing monooxygenase 3 L homeolog antikoerper, FMO3 antikoerper, fmo3 antikoerper, fmo3.L antikoerper, Fmo3 antikoerper

Hintergrund: FMO3 (Flavin-containing Monooxygenase 3) is an enzyme that in humans is encoded by the FMO3 gene. The mammalian flavin-containing monooxygenases (FMO) represent a multigene family whose gene products are localized in the endoplasmic reticulum of many tissues. The FMO3 gene contains 1 noncoding and 8 coding exons. And the FMO3 gene is mapped on 1q24.3. Using quantitative RNase protection assays, FMO3 is present in low abundance in fetal liver and lung and in adult kidney and lung, and in much greater abundance in adult liver. By Western blot analysis of human liver microsomal samples ranging from 8 weeks gestation to 18 years of age, FMO1 is the major fetal isoform and FMO3 is the major adult isoform. FMO3 was expressed at intermediate levels until 11 years of age when a gender-independent increase in FMO3 expression was observed during puberty. Sufferers of trimethylaminuria may display a reduced ability to metabolize substrates for FMO3 such as nicotine. FMO3 metabolizes a number of drugs, including amphetamine, clozapine, deprenyl, metamphetamine, tamoxifen, ethionamide, thiacetazone, and sulindac sulfide.

Synonyms: Dimethylaniline monooxygenase [N oxide forming] 3 antibody|Dimethylaniline monooxygenase [N-oxide-forming] 3 antibody|Dimethylaniline monooxygenase 3 antibody|Dimethylaniline oxidase 3 antibody|dJ127D3.1 antibody|Flavin containing monooxygenase 3 antibody|FMO 3 antibody|FMO form 2 antibody|FMO II antibody|FMO3 antibody|FMO3_HUMAN antibody|FMOII antibody|Hepatic flavin containing monooxygenase 3 antibody|Hepatic flavin-containing monooxygenase 3 antibody|MGC34400 antibody|TMAU antibody|Trimethylamine monooxygenase antibody

Gen-ID: 2328

UniProt: P31513