Aspartate beta Hydroxylase Antikörper (C-Term)

Produktnummer ABIN3043790

Produktdetails anti-Aspartate beta Hydroxylase Antikörper

Target: Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))

Bindungsspezifität: AA 726-758, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aspartate beta Hydroxylase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Aspartyl/asparaginyl beta-hydroxylase(ASPH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: EVWQDASSFR LIFIVDVWHP ELTPQQRRSL PAI

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Aspartyl/asparaginyl beta-hydroxylase(ASPH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aspartate beta-hydroxylase
Protein Name: Aspartyl/asparaginyl beta-hydroxylase

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Aspartate beta Hydroxylase

Target: Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))

Andere Bezeichnung: ASPH (ASPH Produkte)

Synonyme: AAH antikoerper, BAH antikoerper, CASQ2BP1 antikoerper, HAAH antikoerper, JCTN antikoerper, junctin antikoerper, 2310005F16Rik antikoerper, 3110001L23Rik antikoerper, AI848629 antikoerper, AW261690 antikoerper, AW561901 antikoerper, C79816 antikoerper, cI-37 antikoerper, aah antikoerper, bah antikoerper, jctn antikoerper, MGC107896 antikoerper, cb971 antikoerper, fb69e10 antikoerper, fc06d04 antikoerper, fc95a08 antikoerper, wu:fb69e10 antikoerper, wu:fc06d04 antikoerper, wu:fc95a08 antikoerper, aspartate beta-hydroxylase antikoerper, aspartate-beta-hydroxylase antikoerper, aspartate beta-hydroxylase L homeolog antikoerper, ASPH antikoerper, Asph antikoerper, asph antikoerper, asph.L antikoerper

Hintergrund: ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase. This gene is thought to play an important role in calcium homeostasis. And the gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis.

Synonyms: A beta H J J antibody|AAH antibody|ASP beta hydroxylase antibody|Aspartyl/asparaginyl beta hydroxylase antibody|ASPH antibody|ASPH_HUMAN antibody|BAH antibody|Cardiac junctin antibody|CASQ2BP1 antibody|HAAH antibody|Humbug antibody|JCTN antibody|junctin antibody| Peptide aspartate beta dioxygenase antibody

Gen-ID: 444

UniProt: Q12797

Pathways: Positive Regulation of Endopeptidase Activity