Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2) (AA 18-48), (N-Term) Antikörper

Details zu Produkt Nr. ABIN3043782
Antigen
Epitop
AA 18-48, N-Term
27
16
12
11
10
8
6
3
3
2
2
2
2
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
162
44
43
2
2
1
1
1
1
1
1
Wirt
Kaninchen
114
46
7
Klonalität
Polyklonal
Konjugat
Unkonjugiert
12
7
7
7
7
7
2
2
2
2
2
2
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
149
90
87
36
28
28
14
7
6
4
1
Optionen
Verwendungszweck Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial(ALDH2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Sequenz SAAATQAVPA PNQQPEVFCN QIFINNEWHD A
Isotyp IgG
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial(ALDH2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aldehyde dehydrogenase 2 family (mitochondrial)
Protein Name: Aldehyde dehydrogenase, mitochondrial
Reinigung Immunogen affinity purified.
Antigen
Andere Bezeichnung ALDH2 (ALDH2 Antibody Abstract)
Hintergrund ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60 % , most likely through its inhibitory effect on the formation of cytotoxic aldehydes.

Synonyms: Acetaldehyde dehydrogenase 2 antibody|Aldehyde dehydrogenase 2 family (mitochondrial) antibody|Aldehyde dehydrogenase 2 family antibody|Aldehyde dehydrogenase mitochondrial antibody|Aldehyde dehydrogenase, mitochondrial antibody|ALDH 2 antibody|ALDH class 2 antibody|ALDH E2 antibody|ALDH-E2 antibody|Aldh2 antibody|ALDH2_HUMAN antibody|ALDHI antibody|ALDM antibody|Liver mitochondrial ALDH antibody|MGC1806 antibody|Mitochondrial aldehyde dehydrogenase 2 antibody|MS767 antibody|Nucleus encoded mitochondrial aldehyde dehydrogenase 2 antibody
Gen-ID 217
UniProt P05091
Applikations-hinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
Bilder des Herstellers
Image no. 1 for anti-Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2) (AA 18-48), (N-Term) antibody (ABIN3043782) Anti- ALDH2 Picoband antibody, IHC(P) IHC(P): Human Kidney Cancer Tissue
Image no. 2 for anti-Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2) (AA 18-48), (N-Term) antibody (ABIN3043782) Anti- ALDH2 Picoband antibody, Western blotting All lanes: Anti ALDH2 at 0.5ug/ml La...
Image no. 3 for anti-Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2) (AA 18-48), (N-Term) antibody (ABIN3043782) Anti- ALDH2 Picoband antibody, IHC(P) IHC(P): Rat Liver Tissue
Image no. 4 for anti-Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2) (AA 18-48), (N-Term) antibody (ABIN3043782) Anti- ALDH2 Picoband antibody, Western blottingAll lanes: Anti ALDH2 at 0.5ug/ml La...