ALDH2 Antikörper (N-Term)
-
- Target Alle ALDH2 Antikörper anzeigen
- ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2))
-
Bindungsspezifität
- AA 18-48, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALDH2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial(ALDH2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- SAAATQAVPA PNQQPEVFCN QIFINNEWHD A
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial(ALDH2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aldehyde dehydrogenase 2 family (mitochondrial)
Protein Name: Aldehyde dehydrogenase, mitochondrial - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product ALDH2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2))
- Andere Bezeichnung
- ALDH2 (ALDH2 Produkte)
- Hintergrund
-
ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60 % , most likely through its inhibitory effect on the formation of cytotoxic aldehydes.
Synonyms: Acetaldehyde dehydrogenase 2 antibody|Aldehyde dehydrogenase 2 family (mitochondrial) antibody|Aldehyde dehydrogenase 2 family antibody|Aldehyde dehydrogenase mitochondrial antibody|Aldehyde dehydrogenase, mitochondrial antibody|ALDH 2 antibody|ALDH class 2 antibody|ALDH E2 antibody|ALDH-E2 antibody|Aldh2 antibody|ALDH2_HUMAN antibody|ALDHI antibody|ALDM antibody|Liver mitochondrial ALDH antibody|MGC1806 antibody|Mitochondrial aldehyde dehydrogenase 2 antibody|MS767 antibody|Nucleus encoded mitochondrial aldehyde dehydrogenase 2 antibody - Gen-ID
- 217
- UniProt
- P05091
-