alpha 1 Adrenergic Receptor Antikörper (C-Term)

Produktnummer ABIN3043732

Produktdetails anti-alpha 1 Adrenergic Receptor Antikörper

Target: alpha 1 Adrenergic Receptor (ADRA1A) (Adrenoceptor alpha 1A (ADRA1A))

Bindungsspezifität: AA 335-373, C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser alpha 1 Adrenergic Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Alpha-1A adrenergic receptor(ADRA1A) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: KAFQNVLRIQ CLCRKQSSKH ALGYTLHPPS QAVEGQHKD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Alpha-1A adrenergic receptor(ADRA1A) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: adrenoceptor alpha 1A
Protein Name: Alpha-1A adrenergic receptor

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ADRA1A (335-373aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu alpha 1 Adrenergic Receptor

Target: alpha 1 Adrenergic Receptor (ADRA1A) (Adrenoceptor alpha 1A (ADRA1A))

Andere Bezeichnung: ADRA1A (ADRA1A Produkte)

Hintergrund: ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle.

Synonyms: ADA1D_HUMAN antibody|Adra1 antibody|Adra1a antibody|Adra1d antibody|ADRA1R antibody|Adrd1 antibody|Adrenergic alpha1A receptor antibody|Adrenergic alpha1D receptor antibody|Adrenergic receptor alpha 1d antibody|Adrenergic receptor delta1 antibody|Adrenoceptor alpha 1D antibody|Alpha 1D adrenoceptor antibody|Alpha 1D adrenoreceptor antibody|Alpha adrenergic receptor 1a antibody|Alpha-1A adrenergic receptor antibody|Alpha-1D adrenergic receptor antibody|Alpha-1D adrenoceptor antibody|Alpha-1D adrenoreceptor antibody| Alpha-adrenergic receptor 1a antibody|ALPHA1 antibody|Alpha1A adrenergic receptor antibody|Alpha1D adrenergic receptor antibody| Alpha1DAR antibody|DAR antibody|dJ779E11.2 antibody|Gpcr8 antibody|RA42 antibody|Spr8 antibody

Gen-ID: 148

UniProt: P35348

Pathways: AMPK Signaling