TREX1 Antikörper (Middle Region)
-
- Target Alle TREX1 Antikörper anzeigen
- TREX1 (three Prime Repair Exonuclease 1 (TREX1))
-
Bindungsspezifität
- AA 156-185, Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TREX1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Three-prime repair exonuclease 1(TREX1) detection. Tested with WB in Human.
- Sequenz
- DDNLANLLLA FLRRQPQPWC LVAHNGDRYD
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Three-prime repair exonuclease 1(TREX1) detection. Tested with WB in Human.
Gene Name: three prime repair exonuclease 1
Protein Name: Three-prime repair exonuclease 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human TREX1 (156-185aa DDNLANLLLAFLRRQPQPWCLVAHNGDRYD), different from the related mouse sequence by four amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product TREX1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TREX1 (three Prime Repair Exonuclease 1 (TREX1))
- Andere Bezeichnung
- TREX1 (TREX1 Produkte)
- Synonyme
- AGS1 antikoerper, CRV antikoerper, DRN3 antikoerper, HERNS antikoerper, 1661 antikoerper, AU041952 antikoerper, RGD1309596 antikoerper, three prime repair exonuclease 1 antikoerper, CpipJ_CPIJ012074 antikoerper, Tsp_03749 antikoerper, TREX1 antikoerper, Trex1 antikoerper
- Hintergrund
-
Three prime repair exonuclease 1 is an enzyme that in humans is encoded by the TREX1 gene. This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A-mediated cell death. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants.
Synonyms: 3' 5' exonuclease TREX1 antibody|3' repair exonuclease 1 antibody|AGS1 antibody|AGS5 antibody|CRV antibody|Deoxyribonuclease III, dnaQ/mutD (E. coli) like antibody|DKFZp434J0310 antibody|DNase III antibody|DRN3 antibody|HERNS antibody|Three prime repair exonuclease 1 antibody|TREX1 antibody - Gen-ID
- 11277
- Pathways
- Apoptose
-