Fetuin A Antikörper (N-Term)
-
- Target Alle Fetuin A (AHSG) Antikörper anzeigen
- Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))
-
Bindungsspezifität
- AA 33-65, N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Fetuin A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Alpha-2-HS-glycoprotein(AHSG) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
- Sequenz
- DDPETEEAAL VAIDYINQNL PWGYKHTLNQ IDE
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Alpha-2-HS-glycoprotein(AHSG) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
Gene Name: alpha-2-HS-glycoprotein
Protein Name: Alpha-2-HS-glycoprotein - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Fetuin A (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product AHSG Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))
- Andere Bezeichnung
- AHSG (AHSG Produkte)
- Synonyme
- ahs antikoerper, a2hs antikoerper, hsga antikoerper, fetua antikoerper, wu:fb63g02 antikoerper, zgc:103687 antikoerper, AHSG antikoerper, MGC116429 antikoerper, A2HS antikoerper, AHS antikoerper, FETUA antikoerper, HSGA antikoerper, Aa2-066 antikoerper, pp63 antikoerper, alpha-2-HS-glycoprotein antikoerper, alpha 2-HS glycoprotein antikoerper, alpha-2-HS-glycoprotein 1 antikoerper, alpha-2-HS-glycoprotein L homeolog antikoerper, Cphamn1_1981 antikoerper, AHSG antikoerper, ahsg antikoerper, ahsg1 antikoerper, ahsg.L antikoerper, Ahsg antikoerper
- Hintergrund
-
Alpha-2-HS-glycoprotein (AHSG), also known as fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.
Synonyms: 59 kDa bone sialic acid-containing protein antibody|A2HS antibody|Aa2-066 antibody|AHS antibody|Ahsg alpha-2-HS-glycoprotein antibody| Ahsg antibody|Alpha 2 HS Glycoprotein antibody|Alpha 2 Z globulin antibody|Alpha-2-HS-glycoprotein antibody|Alpha-2-HS-glycoprotein chain B antibody|Alpha-2-Z-globulin antibody|Asialofetuin antibody|Ba alpha 2 glycoprotein antibody|Ba-alpha-2-glycoprotein antibody| BSP antibody|Countertrypin antibody|Fetua antibody|FETUA_HUMAN antibody|Fetuin, mouse, homolog of antibody| Fetuin A antibody|Fetuin-A antibody|Glycoprotein PP63 antibody|HSGA antibody|pp63 antibody - Gen-ID
- 197
- UniProt
- P02765
-