LIM Domain Kinase 1 Antikörper (C-Term)

Produktnummer ABIN3043411

Produktdetails anti-LIM Domain Kinase 1 Antikörper

Target: LIM Domain Kinase 1 (LIMK1)

Bindungsspezifität: AA 599-634, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIM Domain Kinase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for LIM domain kinase 1(LIMK1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: KLEHWLETLR MHLAGHLPLG PQLEQLDRGF WETYRR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for LIM domain kinase 1(LIMK1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: LIM domain kinase 1
Protein Name: LIM domain kinase 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 (599-634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-LIM Domain Kinase 1 Antikörper (ABIN3043411)

Zhang, Gan, Zhou: "Immunohistochemical investigation of the correlation between LIM kinase 1 expression and development and progression of human ovarian carcinoma." in: The Journal of international medical research, Vol. 40, Issue 3, pp. 1067-73, (2013) (PubMed).

Details zu LIM Domain Kinase 1

Target: LIM Domain Kinase 1 (LIMK1)

Andere Bezeichnung: LIMK1 (LIMK1 Produkte)

Synonyme: limk1 antikoerper, xlimk1 antikoerper, GB16654 antikoerper, LIMK1 antikoerper, LIMK antikoerper, LIMK-1 antikoerper, LIM domain kinase 1 antikoerper, LIM domain kinase 1a antikoerper, LIM domain kinase 1 L homeolog antikoerper, LIM-domain containing, protein kinase antikoerper, LIMK1 antikoerper, limk1a antikoerper, limk1 antikoerper, CpipJ_CPIJ000717 antikoerper, LOC413152 antikoerper, Limk1 antikoerper, limk1.L antikoerper

Hintergrund: LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.

Synonyms: EC 2.7.11.1 antibody|LIM domain kinase 1 antibody|LIM motif-containing protein kinase antibody|LIMK antibody|LIMK-1 antibody|limk1 antibody|LIMK1_HUMAN antibody

Gen-ID: 3984

UniProt: P53667

Pathways: Caspase Kaskade in der Apoptose, Regulation of Cell Size, CXCR4-mediated Signaling Events