ELAVL4 Antikörper (N-Term)
-
- Target Alle ELAVL4 Antikörper anzeigen
- ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))
-
Bindungsspezifität
- AA 8-45, N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ELAVL4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for ELAV-like protein 4(ELAVL4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- MEPQVSNGPT SNTSNGPSSN NRNCPSPMQT GATTDDSK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for ELAV-like protein 4(ELAVL4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ELAV like neuron-specific RNA binding protein 4
Protein Name: ELAV-like protein 4 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product ELAVL4 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))
- Andere Bezeichnung
- ELAVL4 (ELAVL4 Produkte)
- Hintergrund
-
HuD otherwise known as ELAV-like protein 4 or PNEM is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is an RNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.
Synonyms: ELAV (embryonic lethal abnormal vision Drosophila) like 4 antibody|ELAV L4 antibody|ELAV like 4 antibody|ELAV like protein 4 antibody| ELAV-like protein 4 antibody|ELAV4_HUMAN antibody|Elavl4 antibody|Embryonic lethal abnormal vision Drosophila homolog of like 4 antibody|Hu antigen D antibody|Hu-antigen D antibody|HuD antibody|Paraneoplastic encephalomyelitis antigen HuD antibody|PNEM antibody - Gen-ID
- 1996
- UniProt
- P26378
-