HDAC6 Antikörper (N-Term)

Produktnummer ABIN3042440

Produktdetails anti-HDAC6 Antikörper

Target: HDAC6 (Histone Deacetylase 6 (HDAC6))

Bindungsspezifität: AA 137-169, N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HDAC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Histone deacetylase 6(HDAC6) detection. Tested with WB in Human,Rat.

Sequenz: EKEELMLVHS LEYIDLMETT QYMNEGELRV LAD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Histone deacetylase 6(HDAC6) detection. Tested with WB in Human,Rat.
Gene Name: histone deacetylase 6
Protein Name: Histone deacetylase 6

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HDAC6 (137-169aa EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD), different from the related mouse sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu HDAC6

Target: HDAC6 (Histone Deacetylase 6 (HDAC6))

Andere Bezeichnung: HDAC6 (HDAC6 Produkte)

Synonyme: HD6 antikoerper, Hd6 antikoerper, Hdac5 antikoerper, Sfc6 antikoerper, mHDA2 antikoerper, CG6170 antikoerper, DHDAC2 antikoerper, DmHDAC2 antikoerper, Dmel\\CG6170 antikoerper, HDAC antikoerper, HDAC2 antikoerper, dHDAC2 antikoerper, dHDAC6 antikoerper, dmHDA404 antikoerper, hdac6 antikoerper, MGC53140 antikoerper, wu:fc31d02 antikoerper, dsim_GLEANR_17355 antikoerper, DsimGD17207 antikoerper, GD17207 antikoerper, HDAC6 antikoerper, ATHDA6 antikoerper, AXE1 antikoerper, HISTONE DEACETYLASE 6 antikoerper, MDC12.7 antikoerper, MDC12_7 antikoerper, RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1 antikoerper, RPD3B antikoerper, RTS1 antikoerper, SIL1 antikoerper, histone deacetylase 6 antikoerper, histone deacetylase 6 antikoerper, Histone deacetylase 6 antikoerper, histone deacetylase 6 L homeolog antikoerper, GD17207 gene product from transcript GD17207-RB antikoerper, Histone DeAcetylase antikoerper, HDAC6 antikoerper, Hdac6 antikoerper, hdac6.L antikoerper, hdac6 antikoerper, Dsim\HDAC6 antikoerper, PTRG_03035 antikoerper, HDA6 antikoerper, hda-6 antikoerper

Hintergrund: HDAC6, also called KIAA0901, is a member belongs to class II of the histone deacetylase/acuc/apha family of proteins that is an enzyme that in humans is encoded by the HDAC6 gene. The HDAC6 gene is mapped to chromosome Xp11.23. HDAC6 contains an internal duplication of two catalytic domains which appear to function independently of each other. The protein possesses histone deacetylase activity and represses transcription. HDAC6 functions as a tubulin deacetylase. And it is localized exclusively in the cytoplasm, where it associates with microtubules and localizes with the microtubule motor complex. HDAC6 could bind both polyubiquitinated misfolded proteins and dynein motors, thereby recruiting misfolded protein cargo to dynein motors for transport to aggresomes. Furthermore, expression of HDAC6 was sufficient to rescue degeneration associated with UPS dysfunction in vivo in an autophagy-dependent manner. HDAC6 is a central component of the stress response that regulates SG formation and potentially contributes to control of RNA metabolism and translation.

Synonyms: FLJ16239 antibody|HD 6 antibody|HD6 antibody|HDAC 6 antibody|HDAC6 antibody|HDAC6_HUMAN antibody|Histone deacetylase 6 (HD6) antibody| Histone deacetylase 6 antibody|JM 21 antibody|JM21 antibody|KIAA0901 antibody|OTTHUMP00000032398 antibody|OTTHUMP00000197663 antibody

Gen-ID: 10013

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling