FOXA3 Antikörper (C-Term)

Produktnummer ABIN3042401

Produktdetails anti-FOXA3 Antikörper

Target: FOXA3 (Forkhead Box A3 (FOXA3))

Bindungsspezifität: AA 291-324, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FOXA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma(FOXA3) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: ELKLDAPYNF NHPFSINNLM SEQTPAPPKL DVGF

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma(FOXA3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: forkhead box A3
Protein Name: Hepatocyte nuclear factor 3-gamma

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu FOXA3

Target: FOXA3 (Forkhead Box A3 (FOXA3))

Andere Bezeichnung: FOXA3 (FOXA3 Produkte)

Synonyme: FOXA3 antikoerper, Zffkh1 antikoerper, fa11c04 antikoerper, fkd2 antikoerper, forkhead-2 antikoerper, wu:fa11c04 antikoerper, wu:fc37a08 antikoerper, zf-FKH1 antikoerper, FKHH3 antikoerper, HNF3G antikoerper, TCF3G antikoerper, HNF3-G antikoerper, Hnf-3g antikoerper, Hnf3g antikoerper, Tcf-3g antikoerper, Tcf3g antikoerper, forkhead box A3 antikoerper, FOXA3 antikoerper, foxa3 antikoerper, Foxa3 antikoerper

Hintergrund: Hepatocyte nuclear factor 3-gamma (HNF-3G), also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), is a protein that in humans is encoded by the FOXA3 gene. This gene is mapped to 19q13.32. HNF-3G is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.

Synonyms: FKHH3 antibody|Fork head-related protein FKH H3 antibody|forkhead box A3 antibody|Forkhead box protein A3 antibody|Foxa3 antibody| FOXA3_HUMAN antibody|hepatic nuclear factor-3-beta antibody|hepatocyte nuclear factor 3 antibody|hepatocyte nuclear factor 3 gamma antibody|Hepatocyte nuclear factor 3-gamma antibody|HNF-3-gamma antibody|HNF-3G antibody|HNF3B antibody|HNF3G antibody|TCF-3G antibody|TCF3G antibody|Transcription factor 3G antibody

Gen-ID: 3171

UniProt: P55318

Pathways: Carbohydrate Homeostasis