ERV3 Antikörper (C-Term)
-
- Target Alle ERV3 (ERV3-1) Antikörper anzeigen
- ERV3 (ERV3-1) (Endogenous Retrovirus Group 3, Member 1 (ERV3-1))
-
Bindungsspezifität
- AA 575-604, C-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ERV3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Endogenous retrovirus group 3 member 1 Env polyprotein(ERV3-1) detection. Tested with WB in Human.
- Sequenz
- LELDDEGKVI KEITAKIQKL AHIPVQTWKG
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Endogenous retrovirus group 3 member 1 Env polyprotein(ERV3-1) detection. Tested with WB in Human.
Gene Name: endogenous retrovirus group 3, member 1
Protein Name: Endogenous retrovirus group 3 member 1 Env polyprotein - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human ERV31 (575-604aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG).
- Isotyp
- IgG
- Top Product
- Discover our top product ERV3-1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ERV3 (ERV3-1) (Endogenous Retrovirus Group 3, Member 1 (ERV3-1))
- Andere Bezeichnung
- ERV3-1 (ERV3-1 Produkte)
- Hintergrund
-
HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma.
Synonyms: Endogenous retroviral sequence 3 antibody|Endogenous retrovirus group 3 member 1 antibody|ENR1_HUMAN antibody|Envelope polyprotein antibody|envR antibody|ERV R antibody|ERV-3 envelope protein antibody|ERV-R envelope protein antibody|ERV3 1 envelope protein antibody|ERV3 antibody|ERV3 envelope protein antibody|ERV3-1 antibody|ERVR antibody|FLJ23884 antibody|HERV R antibody|HERV-R envelope protein antibody|HERV-R_7q21.2 provirus ancestral Env polyprotein antibody|HERVR antibody|SU antibody|TM antibody|Transmembrane protein antibody - Gen-ID
- 2086
- UniProt
- Q14264
-