Peroxiredoxin 4 Antikörper (AA 178-2081)

Produktnummer ABIN2743788

Dieses Anti-Peroxiredoxin 4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Peroxiredoxin 4 in WB, IHC, ICC und IHC (p). Geeignet für Human, Maus, Ratte, Pferd, Affe und Orang-Utan.

Kurzübersicht für Peroxiredoxin 4 Antikörper (AA 178-2081) (ABIN2743788)

Target: Peroxiredoxin 4 (PRDX4)

Reaktivität: Human, Maus, Ratte, Pferd, Affe, Orang-Utan

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Peroxiredoxin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-Peroxiredoxin 4 Antikörper

Bindungsspezifität: AA 178-2081

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu Peroxiredoxin 4

Target: Peroxiredoxin 4 (PRDX4)

Andere Bezeichnung: PRDX4 / Peroxiredoxin 4

Hintergrund: Name/Gene ID: PRDX4

Synonyms: PRDX4, Antioxidant enzyme AOE372, AOE37-2, Peroxiredoxin IV, Prx-IV, Thioredoxin peroxidase AO372, Peroxiredoxin-4, PRX-4, Peroxiredoxin 4

Gen-ID: 10549