Caspase 2 Antikörper (AA 378-409)

Produktnummer ABIN2738755

Produktdetails anti-Caspase 2 Antikörper

Target: Caspase 2 (CASP2) (Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2))

Bindungsspezifität: AA 378-409

Reaktivität: Human, Maus, Ratte, Affe, Meerschweinchen, Orang-Utan, Schimpanse, Gibbon

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Caspase 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle.

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CASP2(378-409aa RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu Caspase 2

Target: Caspase 2 (CASP2) (Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2))

Andere Bezeichnung: CASP2 / Caspase 2 (CASP2 Produkte)

Synonyme: xCaspase-2 antikoerper, Caspase-2 antikoerper, ICH-1 antikoerper, Nedd2 antikoerper, CASP-2 antikoerper, ICH1 antikoerper, NEDD-2 antikoerper, NEDD2 antikoerper, PPP1R57 antikoerper, ICH-1L/1S antikoerper, ICH1L1S antikoerper, caspase 2 antikoerper, caspase 2 L homeolog antikoerper, caspase-2 antikoerper, CASP2 antikoerper, casp2.L antikoerper, CpipJ_CPIJ008254 antikoerper, Casp2 antikoerper

Hintergrund: Name/Gene ID: CASP2
Subfamily: Cysteine C14
Family: Protease

Synonyms: CASP2, CASP-2, Caspase-2, PPP1R57, Protease ICH-1, NEDD-2, Caspase 2, ICH1, NEDD2

Gen-ID: 835

Pathways: Apoptose, Caspase Kaskade in der Apoptose, Neurotrophin Signalübertragung