RUNX1 Antikörper (AA 200-233)

Produktnummer ABIN2616047

Produktdetails anti-RUNX1 Antikörper

Target: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Bindungsspezifität: AA 200-233

Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Affe, Schimpanse, Hamster, Orang-Utan

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RUNX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Spezifität: Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human RUNX1(200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg Thimerosal, 0.05 mg sodium azide per 100 μg antibody.

Konservierungsmittel: Sodium azide, Thimerosal (Merthiolate)

Vorsichtsmaßnahmen: This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.

Handhabung: Avoid freeze-thaw cycles.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu RUNX1

Target: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Andere Bezeichnung: AML1 / RUNX1 (RUNX1 Produkte)

Synonyme: RUNX1 antikoerper, runx1 antikoerper, AI462102 antikoerper, AML1 antikoerper, Cbfa2 antikoerper, Pebp2a2 antikoerper, Pebpa2b antikoerper, AML1-EVI-1 antikoerper, AMLCR1 antikoerper, CBFA2 antikoerper, EVI-1 antikoerper, PEBP2aB antikoerper, runxa antikoerper, Runx-1 antikoerper, XAML antikoerper, Xaml1 antikoerper, aml antikoerper, aml-1 antikoerper, aml1 antikoerper, aml1-evi-1 antikoerper, amlcr1 antikoerper, cbfa2 antikoerper, evi-1 antikoerper, pebp2ab antikoerper, Aml1 antikoerper, uncharacterized LOC473981 antikoerper, runt-related transcription factor antikoerper, runt related transcription factor 1 antikoerper, runt-related transcription factor 1 antikoerper, runt related transcription factor 1 L homeolog antikoerper, LOC473981 antikoerper, runt antikoerper, Runx1 antikoerper, RUNX1 antikoerper, runx1 antikoerper, runx1.L antikoerper

Hintergrund: Name/Gene ID: RUNX1

Synonyms: RUNX1, AMLCR1, Aml1 oncogene, AML1, AML1-EVI-1, CBF-alpha-2, CBFA2, Acute myeloid leukemia 1, EVI-1, PEBP2A2, PEA2-alpha B, AML1-EVI-1 fusion protein, Oncogene AML-1, PEBP2-alpha B, PEBP2aB

Gen-ID: 861