POMC Antikörper (AA 138-176)

Produktnummer ABIN2614195

Dieses Anti-POMC-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von POMC in IHC und IHC (p). Geeignet für Human und Affe.

Kurzübersicht für POMC Antikörper (AA 138-176) (ABIN2614195)

Target: POMC (Proopiomelanocortin (POMC))

Reaktivität: Human, Affe

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POMC Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-POMC Antikörper

Bindungsspezifität: AA 138-176

Spezifität: ACTH and MSH are produced by the pituitary gland.

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg sodium azide per 100 μg antibody.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu POMC

Target: POMC (Proopiomelanocortin (POMC))

Andere Bezeichnung: POMC / Proopiomelanocortin

Hintergrund: Name/Gene ID: POMC
Family: Hormone

Synonyms: POMC, Alpha-MSH, ACTH, Adrenocorticotropin, Adrenocorticotropic hormone, Beta-LPH, CLIP, Gamma-MSH, Lipotropin gamma, LPH, Melanotropin alpha, Met-enkephalin, Melanotropin beta, NPP, Pro-ACTH-endorphin, Lipotropin beta, Melanotropin gamma, MSH, Proopiomelanocortin, Beta-endorphin, Beta-MSH, Corticotropin-lipotropin, Gamma-LPH, POC, Pro-opiomelanocortin

Gen-ID: 5443

Pathways: Metabolism of Steroid Hormones and Vitamin D, Peptide Hormone Metabolism, Hormone Activity, Feeding Behaviour