FARP1 Antikörper (FERM, RhoGEF (ARHGEF) and Pleckstrin Domain Protein 1 (Chondrocyte-Derived)) (AA 1-129) Primary Antibody
-
- Target
- FARP1
- Bindungsspezifität
- AA 1-129
- Reaktivität
- Human
- Wirt
- Maus
- Klonalität
- Polyklonal
- Konjugat
- Dieser FARP1 Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Verwendungszweck
- Mouse polyclonal antibody raised against a full-length human FARP1 protein.
- Kreuzreaktivität
- Human
- Immunogen
immunogen: FARP1 (NP_001001715.1, 1 a.a. ~ 129 a.a) full-length human protein.
Immunogen Sequence: MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPMVSSSSFLKAIGSSWTGWVLRCSMKPKHHSHLIEKFGEDRILTHLTGSISYTNWAGSRSLAVTVTEELLNLF
-
anti-FERM, RhoGEF (ARHGEF) and Pleckstrin Domain Protein 1 (Chondrocyte-Derived) (FARP1) (N-Term) antibody Primary Antibody
FARP1 Reaktivität: Human ELISA, FACS, IF Wirt: Ziege Polyclonal unconjugated
anti-FERM, RhoGEF (ARHGEF) and Pleckstrin Domain Protein 1 (Chondrocyte-Derived) (FARP1) (AA 471-549) antibody Primary AntibodyFARP1 Reaktivität: Human IF, ELISA, WB Wirt: Maus Monoclonal 2D4 unconjugated
anti-FERM, RhoGEF (ARHGEF) and Pleckstrin Domain Protein 1 (Chondrocyte-Derived) (FARP1) (AA 62-90), (N-Term) antibody Primary AntibodyFARP1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-FERM, RhoGEF (ARHGEF) and Pleckstrin Domain Protein 1 (Chondrocyte-Derived) (FARP1) antibody Primary AntibodyFARP1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Kommentare
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- In 1x PBS, pH 7.4
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- FARP1
- Andere Bezeichnung
- FARP1 (FARP1 Antibody Abstract)
- Synonyme
- FARP1, CDEP, PLEKHC2, PPP1R75, AW228844, BC030329, Cdep, FERM, ARH/RhoGEF and pleckstrin domain protein 1, FERM, RhoGEF (Arhgef) and pleckstrin domain protein 1 (chondrocyte-derived), FARP1, Farp1
- Hintergrund
- Full Gene Name: FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
Synonyms: CDEP,MGC87400,PLEKHC2 - Gen-ID
- 10160
- NCBI Accession
- NP_001001715, NM_001001715